PDB entry 2wag

View 2wag on RCSB PDB site
Description: the structure of a family 25 glycosyl hydrolase from bacillus anthracis.
Class: hydrolase
Keywords: hydrolase, gh25, lysin, lysozyme, bacillus anthracis
Deposited on 2009-02-06, released 2009-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.18859
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme, putative
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WAG (Start-10)
    • Uniprot Q81YN8 (11-End)
    Domains in SCOPe 2.06: d2waga1, d2waga2
  • Heterogens: 15P, SO4, GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wagA (A:)
    mgsshhhhhhmdryeikgvdvasyqgdidwrelekqnmkfafikategsafvdkyfsknw
    tnanktsmrvgayhffsfdskgetqaeqfirnvpkykqalppvidvefyankkdnppkre
    dvtkelsvmiemlekhygkkvilyatqeaydlyikdaypqcdiwirsvltkpslsderkw
    tfwqytnrgklsgyngkekyidlnvfygneeefenygmkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wagA (A:)
    gsshhhhhhmdryeikgvdvasyqgdidwrelekqnmkfafikategsafvdkyfsknwt
    nanktsmrvgayhffsfdskgetqaeqfirnvpkykqalppvidvefyankkdnppkred
    vtkelsvmiemlekhygkkvilyatqeaydlyikdaypqcdiwirsvltkpslsderkwt
    fwqytnrgklsgyngkekyidlnvfygneeefenygm