PDB entry 2wa7

View 2wa7 on RCSB PDB site
Description: structure of the m202v mutant of human filamin b actin binding domain at 1.85 angstroms resolution
Class: structural protein
Keywords: disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton, actin-binding, calponin homology domain, phosphoprotein, differentiation, atelosteogenesis, mutant, filamin, dwarfism, ch domain, developmental protein
Deposited on 2009-02-03, released 2009-06-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.19358
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WA7
      • engineered mutation (204)
    • Uniprot O75369
    Domains in SCOPe 2.05: d2wa7a1, d2wa7a2
  • Heterogens: CAC, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wa7A (A:)
    gamapvtekdlaedapwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrliallevl
    sqkrmyrkyhqrptfrqmqlenvsvalefldresiklvsidskaivdgnlklilglvwtl
    ilhysismpvwedegdddakkqtpkqrllgwiqnkipylpitnfnqnwqdgkalgalvds
    capglcpdweswdpqkpvdnareavqqaddwlgvpqvitpeeiihpdvdehsvmtylsqf
    pkakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wa7A (A:)
    apwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrliallevlsqkrmyrkyhqrpt
    frqmqlenvsvalefldresiklvsidskaivdgnlklilglvwtlilhysismpvwede
    gkkqtpkqrllgwiqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswdpqkpv
    dnareavqqaddwlgvpqvitpeeiihpdvdehsvmtylsqfpka