PDB entry 2w8y

View 2w8y on RCSB PDB site
Description: ru486 bound to the progesterone receptor in a destabilized agonistic conformation
Class: receptor
Keywords: receptor, progesterone receptor, ru-486, mifepristone
Deposited on 2009-01-20, released 2009-04-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W8Y
    • Uniprot P06401 (Start-259)
    Domains in SCOPe 2.06: d2w8ya_
  • Chain 'B':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W8Y
    • Uniprot P06401 (Start-259)
    Domains in SCOPe 2.06: d2w8yb_
  • Heterogens: 486, SO4, NDR, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w8yA (A:)
    gshmgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkws
    kslpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkess
    fyslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyireli
    kaiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsevi
    aaqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w8yA (A:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfhkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w8yB (B:)
    gshmgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkws
    kslpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkess
    fyslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyireli
    kaiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsevi
    aaqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w8yB (B:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfhkk