PDB entry 2w8r

View 2w8r on RCSB PDB site
Description: The crystal structure of human SSADH in complex with NAD+
Class: oxidoreductase
Keywords: mitochondrion, oxidoreductase, transit peptide, ssa, nad, gaba, ssadh, mitochondria, disease mutation
Deposited on 2009-01-19, released 2009-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinate-semialdehyde dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51649 (Start-486)
      • engineered mutation (291)
    Domains in SCOPe 2.07: d2w8ra_
  • Heterogens: ADP, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w8rA (A:)
    grlaglsaallrtdsfvggrwlpaaatfpvqdpasgaalgmvadcgvrearaavraayea
    fcrwrevsakerssllrkwynlmiqnkddlariitaesgkplkeahgeilysafflewfs
    eearrvygdiihtpakdrralvlkqpigvaavitpwnfpsamitrkvgaalaagctvvvk
    paedtpfsalalaelasqagipsgvynvipcsrknakevgeaictdplvskisftgsttt
    gkillhhaansvkrvsmelgglapfivfdsanvdqavagamaskfrntgqtavcsnqflv
    qrgihdafvkafaeamkknlrvgngfeegttqgplinekavekvekqvndavskgatvvt
    ggkrhqlgknffeptllcnvtqdmlctheetfgplapvikfdteeeaiaianaadvglag
    yfysqdpaqiwrvaeqlevgmvgvneglissvecpfggvkqsglgregskygideylelk
    yvcyggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w8rA (A:)
    laglsaallrtdsfvggrwlpaaatfpvqdpasgaalgmvadcgvrearaavraayeafc
    rwrevsakerssllrkwynlmiqnkddlariitaesgkplkeahgeilysafflewfsee
    arrvygdiihtpakdrralvlkqpigvaavitpwnfpsamitrkvgaalaagctvvvkpa
    edtpfsalalaelasqagipsgvynvipcsrknakevgeaictdplvskisftgstttgk
    illhhaansvkrvsmelgglapfivfdsanvdqavagamaskfrntgqtavcsnqflvqr
    gihdafvkafaeamkknlrvgngfeegttqgplinekavekvekqvndavskgatvvtgg
    krhqlgknffeptllcnvtqdmlctheetfgplapvikfdteeeaiaianaadvglagyf
    ysqdpaqiwrvaeqlevgmvgvneglissvecpfggvkqsglgregskygideylelkyv
    cyggl