PDB entry 2w83

View 2w83 on RCSB PDB site
Description: crystal structure of the arf6 gtpase in complex with a specific effector, jip4
Class: protein transport
Keywords: golgi apparatus, protein transport, er-golgi transport, arf, gtpase, effector, myristate, cytoplasm, nucleotide-binding, alternative splicing, GTP-binding, phosphoprotein, heterotetramer, transport, coiled-coil, lipoprotein, coiled coil
Deposited on 2009-01-08, released 2009-07-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.217
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W83 (Start-1)
      • engineered mutation (56)
    • Uniprot P62330 (2-End)
    Domains in SCOPe 2.06: d2w83a_
  • Chain 'B':
    Compound: ADP-ribosylation factor 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W83 (Start-1)
      • engineered mutation (56)
    • Uniprot P62330 (2-End)
    Domains in SCOPe 2.06: d2w83b_
  • Chain 'C':
    Compound: c-jun-amino-terminal kinase-interacting protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W83 (0-5)
    • Uniprot O60271 (6-End)
  • Chain 'D':
    Compound: c-jun-amino-terminal kinase-interacting protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W83 (Start-5)
    • Uniprot O60271 (6-End)
  • Chain 'E':
    Compound: ADP-ribosylation factor 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W83 (0-1)
      • engineered mutation (56)
    • Uniprot P62330 (2-End)
    Domains in SCOPe 2.06: d2w83e_
  • Heterogens: GTP, MG, DIO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w83A (A:)
    amemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldki
    rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam
    kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w83A (A:)
    memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
    plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
    pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w83B (B:)
    amemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldki
    rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam
    kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w83B (B:)
    memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
    plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
    pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2w83E (E:)
    amemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldki
    rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam
    kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w83E (E:)
    amemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldki
    rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam
    kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsn