PDB entry 2w7w

View 2w7w on RCSB PDB site
Description: the crystal structure of iron superoxide dismutase from aliivibrio salmonicida.
Class: oxidoreductase
Keywords: dsc, sodb, fesod, oxidoreductase, cold adaptation, structural analysis, superoxide dismutase, differential scanning calorimetry, aliivibrio salmonicida
Deposited on 2009-01-06, released 2009-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-17, with a file datestamp of 2009-02-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.207
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase [fe]
    Species: ALIIVIBRIO SALMONICIDA [TaxId:316275]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w7wa1, d2w7wa2
  • Chain 'B':
    Compound: superoxide dismutase [fe]
    Species: ALIIVIBRIO SALMONICIDA [TaxId:316275]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w7wb1, d2w7wb2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w7wA (A:)
    msfelpalpfakdalephisaetldyhhgkhhntyvvklnglipgtefegktleeiikts
    tggvfnnaaqiwnhtfywnclapnaggqptgavaaaidaafgsfeefkakftdsainnfg
    sswtwlvknadgslaivntsnaatpltdegvtplltvdlwehayyidfrnvrpdymgafw
    slvnwsfveenlak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w7wA (A:)
    sfelpalpfakdalephisaetldyhhgkhhntyvvklnglipgtefegktleeiiktst
    ggvfnnaaqiwnhtfywnclapnaggqptgavaaaidaafgsfeefkakftdsainnfgs
    swtwlvknadgslaivntsnaatpltdegvtplltvdlwehayyidfrnvrpdymgafws
    lvnwsfveenlak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w7wB (B:)
    msfelpalpfakdalephisaetldyhhgkhhntyvvklnglipgtefegktleeiikts
    tggvfnnaaqiwnhtfywnclapnaggqptgavaaaidaafgsfeefkakftdsainnfg
    sswtwlvknadgslaivntsnaatpltdegvtplltvdlwehayyidfrnvrpdymgafw
    slvnwsfveenlak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w7wB (B:)
    sfelpalpfakdalephisaetldyhhgkhhntyvvklnglipgtefegktleeiiktst
    ggvfnnaaqiwnhtfywnclapnaggqptgavaaaidaafgsfeefkakftdsainnfgs
    swtwlvknadgslaivntsnaatpltdegvtplltvdlwehayyidfrnvrpdymgafws
    lvnwsfveenlak