PDB entry 2w5i

View 2w5i on RCSB PDB site
Description: RNAse a-ap3a complex
Class: hydrolase
Keywords: glycoprotein, endonuclease, hydrolase, inhibitor, nucleotide ATP, enzyme, nuclease, secreted, glycation
Deposited on 2008-12-10, released 2009-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w5ia_
  • Chain 'B':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w5ib_
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w5iA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w5iA (A:)
    etaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsqk
    nvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfd
    asv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w5iB (B:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv