PDB entry 2w57

View 2w57 on RCSB PDB site
Description: crystal structure of the vibrio cholerae ferric uptake regulator (fur) reveals structural rearrangement of the DNA-binding domains
Class: metal transport
Keywords: gene regulation, vibrio cholerae, transcription regulation, metal transport, iron, repressor, DNA-binding, transcription, metal-binding, ferric uptake
Deposited on 2008-12-05, released 2009-01-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric uptake regulation protein
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2w57a_
  • Chain 'B':
    Compound: ferric uptake regulation protein
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2w57b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w57A (A:)
    msdnnqalkdaglkvtlprlkilevlqqpecqhisaeelykklidlgeeiglatvyrvln
    qfddagivtrhhfeggksvfelstqhhhdhlvcldcgeviefsddvieqrqkeiaakynv
    qltnhslylygkcgsdgsckdnpnahkpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w57A (A:)
    dnnqalkdaglkvtlprlkilevlqqpecqhisaeelykklidlgeeiglatvyrvlnqf
    ddagivtrhhfeggksvfelstqhhhdhlvcldcgeviefsddvieqrqkeiaakynvql
    tnhslylygkc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w57B (B:)
    msdnnqalkdaglkvtlprlkilevlqqpecqhisaeelykklidlgeeiglatvyrvln
    qfddagivtrhhfeggksvfelstqhhhdhlvcldcgeviefsddvieqrqkeiaakynv
    qltnhslylygkcgsdgsckdnpnahkpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w57B (B:)
    dnnqalkdaglkvtlprlkilevlqqpecqhisaeelykklidlgeeiglatvyrvlnqf
    ddagivtrhhfeggksvfelstqhhhdhlvcldcgeviefsddvieqrqkeiaakynvql
    tnhslylygkc