PDB entry 2w2x

View 2w2x on RCSB PDB site
Description: complex of rac2 and plcg2 spph domain
Class: signaling protein/hydrolase
Keywords: hydrolase, phospholipase c, phosphoinositides, rho gtpases, rac, sh2 domain, sh3 domain, signaling protein/hydrolase
Deposited on 2008-11-04, released 2009-05-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.237
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W2X (Start-6)
      • engineered mutation (17)
      • conflict (31)
      • conflict (93)
      • conflict (102)
    • Uniprot P15153 (7-End)
    Domains in SCOPe 2.05: d2w2xa_
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W2X
      • engineered mutation (17)
      • conflict (31)
      • conflict (93)
      • conflict (102)
    • Uniprot P15153 (7-End)
    Domains in SCOPe 2.05: d2w2xb_
  • Chain 'C':
    Compound: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: GSP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w2xA (A:)
    gggsggsqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvdskpvnlg
    lwdtagqedydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvg
    tkldlrddkdtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeair
    avlcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2xA (A:)
    sqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvdskpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvgtkldlr
    ddkdtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeairavl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w2xB (B:)
    gggsggsqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvdskpvnlg
    lwdtagqedydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvg
    tkldlrddkdtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeair
    avlcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2xB (B:)
    qaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvvnlglwdtagqedydrl
    rplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvgtkldlrddkdtie
    klkekklapitypqglalakeidsvkylecsaltqrglktvfdeairavl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.