PDB entry 2w2v

View 2w2v on RCSB PDB site
Description: rac2 (g12v) in complex with gtpgs
Class: signaling protein
Keywords: ADP-ribosylation, cytoplasm, direct protein sequencing, disease mutation, GTP-binding, lipoprotein, methylation, nucleotide-binding, polymorphism, prenylation, signaling protein, phospholipase c, phosphoinositides, rho
Deposited on 2008-11-04, released 2009-05-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.283
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W2V
      • engineered mutation (18)
    • Uniprot P15153 (7-183)
    Domains in SCOPe 2.03: d2w2va_
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W2V
      • engineered mutation (18)
    • Uniprot P15153
    Domains in SCOPe 2.03: d2w2vb_
  • Chain 'C':
    Compound: ras-related c3 botulinum toxin substrate 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W2V
      • engineered mutation (18)
    • Uniprot P15153 (7-End)
    Domains in SCOPe 2.03: d2w2vc_
  • Chain 'D':
    Compound: ras-related c3 botulinum toxin substrate 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W2V
      • engineered mutation (18)
    • Uniprot P15153 (7-183)
    Domains in SCOPe 2.03: d2w2vd_
  • Heterogens: GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w2vA (A:)
    gggsggsmqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvdskpvnl
    glwdtagqedydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilv
    gtkldlrddkdtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeai
    ravl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2vA (A:)
    mqaikcvvvgdvavgktcllisyttnafpiptvfdnysanvmvpvnlglwdtagqedydr
    lrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvgtkldlrddkdti
    eklkekklapitypqglalakeidsvkylecsaltqrglktvfdeairavl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w2vB (B:)
    gggsggsmqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvdskpvnl
    glwdtagqedydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilv
    gtkldlrddkdtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeai
    ravl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2vB (B:)
    qaikcvvvgdvavgktcllisyttnafpgiptvfdnysanvmvdskpvnlglwdtagqed
    ydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvgtkldlrddk
    dtieklklapitypqglalakeidsvkylecsaltqrglktvfdeairav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2w2vC (C:)
    gggsggsmqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvdskpvnl
    glwdtagqedydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilv
    gtkldlrddkdtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeai
    ravl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2vC (C:)
    mqaikcvvvgdvavgktcllisyttnafpiptvfdnysanvmvvnlglwdtagqedydrl
    rplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvgtkldlrddkdtia
    pitypqglalakeidsvkylecsaltqrglktvfdeairav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2w2vD (D:)
    gggsggsmqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvdskpvnl
    glwdtagqedydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilv
    gtkldlrddkdtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeai
    ravl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2vD (D:)
    mqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvpvnlglwdtagqed
    ydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvgtkldlrddk
    dtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeairavl