PDB entry 2w2t

View 2w2t on RCSB PDB site
Description: rac2 (g12v) in complex with GDP
Class: signaling protein
Keywords: signaling protein, phospholipase c, phosphoinositides, rho gtpases, rac signaling protein
Deposited on 2008-11-04, released 2009-05-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.21
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2W2T
      • engineered mutation (17)
    • Uniprot P15153 (7-184)
    Domains in SCOPe 2.06: d2w2ta_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w2tA (A:)
    gggsggsqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvdskpvnlg
    lwdtagqedydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvg
    tkldlrddkdtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeair
    avlcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2tA (A:)
    qaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvdskpvnlglwdtagq
    edydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvgtkldlrd
    dkdtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeairavlcp