PDB entry 2w27

View 2w27 on RCSB PDB site
Description: crystal structure of the bacillus subtilis ykui protein, with an eal domain, in complex with substrate c-di-gmp and calcium
Class: signaling protein
Keywords: protein structure initiative, signaling protein, structural genomics, psi, mcsg, eal domain, ykui protein, cyclic di-gmp
Deposited on 2008-10-24, released 2009-02-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.228
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YkuI protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W27
    • Uniprot O35014 (Start-430)
    Domains in SCOPe 2.03: d2w27a1, d2w27a2
  • Chain 'B':
    Compound: YkuI protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W27
    • Uniprot O35014 (24-End)
    Domains in SCOPe 2.03: d2w27b1, d2w27b2
  • Heterogens: 5GP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w27A (A:)
    mhhhhhhssgvdlgtenlyfqsnamldpldiltniddvlpyyqaifsaeeqkvvgyevlg
    riladseiqslgpffldagipeeyklevdnriirqaldrfleadsdllifmnqdanllml
    dhgesflellkeyeakgielhrfvleitehnfegdieqlyhmlayyrtygikiavdnigk
    essnldriallspdllkidlqalkvsqpspsyehvlysisllarkigaallyedieanfq
    lqyawrnggryfqgyylvspsetflerdvlkqrlktefhqfithekkkletvyehseqfy
    krvhqavtslrknnlssdddfikklaeeltdcsfriymcdeegdqltgnvfkqdgewiyq
    peyaeknwswrpyflenimrmrnlrkgffsdlysdletgemirtfsypmddqmylfidlp
    ysylyeqdgli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w27A (A:)
    ldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeeyk
    levdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfvl
    eitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalsp
    syehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetflerdvl
    kqrlktefhqfithekkkletvyehseqfykrvhqavtslrknnlssdddfikklaeelt
    dcsfriymcdeegdqltgnvfkqdgewiyqpeyaeknwswrpyflenimrmrnlrkgffs
    dlysdletgemirtfsypmddqmylfidlpysylyeqdgli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w27B (B:)
    mhhhhhhssgvdlgtenlyfqsnamldpldiltniddvlpyyqaifsaeeqkvvgyevlg
    riladseiqslgpffldagipeeyklevdnriirqaldrfleadsdllifmnqdanllml
    dhgesflellkeyeakgielhrfvleitehnfegdieqlyhmlayyrtygikiavdnigk
    essnldriallspdllkidlqalkvsqpspsyehvlysisllarkigaallyedieanfq
    lqyawrnggryfqgyylvspsetflerdvlkqrlktefhqfithekkkletvyehseqfy
    krvhqavtslrknnlssdddfikklaeeltdcsfriymcdeegdqltgnvfkqdgewiyq
    peyaeknwswrpyflenimrmrnlrkgffsdlysdletgemirtfsypmddqmylfidlp
    ysylyeqdgli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w27B (B:)
    mldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeey
    klevdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfv
    leitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalk
    spsyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetflerd
    vlkqrlktefhqfithekkkletvyehseqfykrvhqavtslrknnlssdddfikklaee
    ltdcsfriymcdeegdqltgnvfkqdgewiyqpeyaeknwswrpyflenimrmrnlrkgf
    fsdlysdletgemirtfsypmddqmylfidlpysy