PDB entry 2w21

View 2w21 on RCSB PDB site
Description: crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli.
Class: transferase
Keywords: amino acid kinase family, proline biosynthesis, amino-acid biosynthesis, kinase, cytoplasm, transferase, glutamate kinaseamino acid kinase family, glutamate kinase
Deposited on 2008-10-21, released 2009-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.209
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate 5-kinase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7B5
      • engineered mutation (128)
    Domains in SCOPe 2.07: d2w21a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w21A (A:)
    msdsqtlvvklgtsvltggsrrlnrahivelvrqcaqlhaaghrivivtsgaiaagrehl
    gypelpatiaskqllaavgqsrliqlweqlfsiygihvgqmlltradmedrerflnardt
    lralldnnvvpvinendavataeikvgdndnlsalaailagadklllltdqkglytadpr
    snpqaelikdvygiddalraiagdsvsglgtggmstklqaadvacragidtiiaagskpg
    vigdvmegisvgtlfhaqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w21A (A:)
    dsqtlvvklgtsvltggsrrlnrahivelvrqcaqlhaaghrivivtsgaiaagrehlgy
    pelpatiaskqllaavgqsrliqlweqlfsiygihvgqmlltradmedrerflnardtlr
    alldnnvvpvinendavataikvgdndnlsalaailagadklllltdqkglytadprsnp
    qaelikdvygiddalraiaggmstklqaadvacragidtiiaagskpgvigdvmegisvg
    tlfhaq