PDB entry 2w14

View 2w14 on RCSB PDB site
Description: High-resolution crystal structure of the P-I snake venom metalloproteinase BaP1 in complex with a peptidomimetic: insights into inhibitor binding
Class: hydrolase/inhibitor
Keywords: HYDROLASE INHIBITOR COMPLEX, METAL-BINDING, ZINC-DEPENDING, METALLOPROTEASE, METALLOPROTEINASE-INHIBITOR COMPLEX, ZINC, TOXIN, SECRETED, PROTEASE, HYDROLASE, P-I SNAKE VENOM METALLOPROTEINASE, METZINCIN, CHEMOTAXIS, ADAMALYSIN, ENDOPEPTIDASE, ALPHA-BETA PROTEIN, MATRIXMETALLOPROTEINASE, TUMOR NECROSIS FACTOR ALPHA CONVERTING ENZYME, PYRROLIDONE CARBOXYLIC ACID, HYDROLASE-INHIBITOR complex
Deposited on 2008-10-14, released 2009-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc metalloproteinase bap1
    Species: Bothrops asper [TaxId:8722]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w14a_
  • Heterogens: ZN, WR2, GOL, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w14A (A:)
    erfspryielavvadhgiftkynsnlntirtrvhemlntvngfyrsvdvhaplanlevws
    kqdlikvqkdssktlksfgewrerdllprishdhaqlltavvfdgntigraytggmcdpr
    hsvgvvrdhsknnlwvavtmahelghnlgihhdtgscscgakscimasvlskvlsyefsd
    csqnqyetyltnhnpqcilnkp