PDB entry 2w0l

View 2w0l on RCSB PDB site
Description: crystal structure of the mutant h8p from the recombinant variable domain 6jal2
Class: immune system
Keywords: fibrils, germ line, antibodies, fibrinogenic, immune system
Deposited on 2008-08-19, released 2009-11-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: v1-22 protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5NV88 (0-97)
    • engineered mutation (7)
  • PDB 2W0L (97-110)
• Chain 'B':
  Compound: v1-22 protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5NV88 (0-97)
    • engineered mutation (7)
  • PDB 2W0L (97-110)
• Chain 'C':
  Compound: v1-22 protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5NV88 (0-97)
    • engineered mutation (7)
  • PDB 2W0L (97-110)
• Chain 'D':
  Compound: v1-22 protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5NV88 (0-97)
    • engineered mutation (7)
  • PDB 2W0L (97-110)
  Domains in SCOPe 2.02: d2w0ld_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2w0lD (D:)
  nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
  drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl