PDB entry 2w0k
View 2w0k on RCSB PDB site
Description: crystal structure of the recombinant variable domain 6jal2
Class: immune system
Keywords: fibrils, germ line, antibodies, fibrinogenic, immune system
Deposited on
2008-08-19, released
2009-11-17
The last revision prior to the SCOPe 2.03 freeze date was dated
2011-07-13, with a file datestamp of
2011-06-02.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.212
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: v1-22 protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5NV88 (0-97)
- PDB 2W0K (98-110)
Domains in SCOPe 2.03: d2w0ka_ - Chain 'B':
Compound: v1-22 protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5NV88 (0-97)
- PDB 2W0K (98-110)
Domains in SCOPe 2.03: d2w0kb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2w0kA (A:)
nfmltqphsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2w0kB (B:)
nfmltqphsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl