PDB entry 2w0i

View 2w0i on RCSB PDB site
Description: Structure Of C-Terminal Actin Depolymerizing Factor Homology (Adf-H) Domain Of Human Twinfilin-2
Class: transferase
Keywords: cytoskeleton, actin-binding, actin binding, cofilin-like, phosphoprotein, phosphorylation, transferase, protein tyrosine kinase-9, actin depolymerizing factor
Deposited on 2008-08-18, released 2008-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: twinfilin-2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2W0I (0-1)
    • conflict (130)
  • Uniprot Q6IBS0 (2-134)
  Domains in SCOPe 2.08: d2w0ia_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2w0iA (A:)
  smplqpeaqralqqlkqkmvnyiqmkldleretielvhteptdvaqlpsrvprdaaryhf
  flykhthegdplesvvfiysmpgykcsikermlysscksrlldsveqdfhleiakkieig
  dgaeltaeflddevh