PDB entry 2w0a

View 2w0a on RCSB PDB site
Description: cyp51 of m. tuberculosis bound to an inhibitor n-[(1s)-2-methyl-1-(pyridin-4-ylcarbamoyl)propyl] cyclohexanecarboxamide
Class: oxidoreductase
Keywords: steroid biosynthesis, protein-inhibitor complex, metal-binding, oxidoreductase, lipid synthesis, nadp, iron, heme, cytoplasm, monooxygenase, x-ray diffraction, sterol biosynthesis
Deposited on 2008-08-12, released 2009-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-10, with a file datestamp of 2009-02-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.193
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 51
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A512
      • engineered mutation (36)
      • conflict (85)
      • engineered mutation (441)
    • PDB 2W0A
    Domains in SCOPe 2.07: d2w0aa_
  • Heterogens: HEM, CII, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w0aA (A:)
    msavalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshane
    fffragdddldqakaypfmtpifgeavvfdasperrkemlhnaalrgeqmkghaatiedq
    vrrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdpla
    yvdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtpr
    fsadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfha
    lrqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfp
    dphdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefema
    qppesyrndhskmvvqlaqpaavryrrrtgvhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w0aA (A:)
    avalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshaneff
    fragdddldqakaypfmtpifgeavvfrgeqmkghaatiedqvrrmiadwgeageidlld
    ffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesfrrrdear
    nglvalvadimngrianpdrdmldvliavkagtprfsadeitgmfismmfaghhtssgta
    swtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlrlhppliilm
    rvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqedllnrwtwi
    pfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvqlaqpaavry
    rrrtg