PDB entry 2vzv

View 2vzv on RCSB PDB site
Description: substrate complex of amycolatopsis orientalis exo-chitosanase csxa e541a with chitosan
Class: hydrolase
Keywords: exo-beta-d-glucosaminidase, gh2, csxa, chitosan, glycoside hydrolase, hydrolase
Deposited on 2008-08-05, released 2008-10-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.186
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exo-beta-d-glucosaminidase
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VZV
      • engineered mutation (540)
      • conflict (749)
    • Uniprot Q56F26
    Domains in SCOPe 2.04: d2vzva1, d2vzva2, d2vzva3, d2vzva4, d2vzva5
  • Chain 'B':
    Compound: exo-beta-d-glucosaminidase
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VZV
      • engineered mutation (540)
      • conflict (749)
    • Uniprot Q56F26
    Domains in SCOPe 2.04: d2vzvb1, d2vzvb2, d2vzvb3, d2vzvb4, d2vzvb5
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vzvA (A:)
    vsfrqkrtripllamtvtalaaavcgvttapaatgaevavplsvgaaagnatpipgyviq
    ssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystnmqnvpaaqfsvp
    wwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytrhdlditaqvhtg
    vnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsgavalrsahviqklns
    aldhadltvkadvrndsanavqttvagtvagkpisqtvslaakerktvtfplvgldrpnv
    wwpagmggqhrydldltasvggtpsdaakskfgvrdvkatlnssggrqysvngkpllirg
    ggytpdlflrwnetaaadklkyvlnlglntvrleghiepdeffdiaddlgvltmpgwecc
    dkwegqvngeekgepwvesdypiakasmfseaerlrdhpsvisfhigsdfapdrrieqgy
    ldamkaadfllpvipaasarpspitgasgmkmngpydyvppvywydksqkdrggawsfns
    atsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssdtfgnlklfgdaltkrygas
    anlndfvrkaqlsqyenvraefeshsrnytdstnpstgliywmlnspwtslhwqlfdaym
    dqngayygakkaneplhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntkt
    glsvgalgakatavtvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwggsd
    wyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvdskv
    vdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvpadg
    sgpgpsdpvdyqaedativqgavesnhagytgtgfvnydnvagssvewtvtvpsagtydv
    vvryangtttsrpldfsvngsisasgvafgstgtwpawttktvrvtlaagvnkikavatt
    anggpnvdkitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vzvA (A:)
    lsvgaaagnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkya
    dpfystnmqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdq
    vngaytrhdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlv
    rrsgavalrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvsla
    akerktvtfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvrdvkatl
    nssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleghiepde
    ffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerlrdhpsv
    isfhigsdfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngpydyvpp
    vywydksqkdrggawsfnsatsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssd
    tfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnpstgliy
    wmlnspwtslhwqlfdaymdqngayygakkaneplhiqyshdnrsvvvinqtsnavsglt
    attklynldgtekysntktglsvgalgakatavtvpavsglsttylaknvltdssgkevs
    rnvywlstkadtlnwggsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttv
    tlkntsggrlpafyvdskvvdsagkpvlpvewndnavslwpgetttltakyrtadlkgsk
    psvrisgwntgtqtvpad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vzvB (B:)
    vsfrqkrtripllamtvtalaaavcgvttapaatgaevavplsvgaaagnatpipgyviq
    ssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystnmqnvpaaqfsvp
    wwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytrhdlditaqvhtg
    vnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsgavalrsahviqklns
    aldhadltvkadvrndsanavqttvagtvagkpisqtvslaakerktvtfplvgldrpnv
    wwpagmggqhrydldltasvggtpsdaakskfgvrdvkatlnssggrqysvngkpllirg
    ggytpdlflrwnetaaadklkyvlnlglntvrleghiepdeffdiaddlgvltmpgwecc
    dkwegqvngeekgepwvesdypiakasmfseaerlrdhpsvisfhigsdfapdrrieqgy
    ldamkaadfllpvipaasarpspitgasgmkmngpydyvppvywydksqkdrggawsfns
    atsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssdtfgnlklfgdaltkrygas
    anlndfvrkaqlsqyenvraefeshsrnytdstnpstgliywmlnspwtslhwqlfdaym
    dqngayygakkaneplhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntkt
    glsvgalgakatavtvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwggsd
    wyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvdskv
    vdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvpadg
    sgpgpsdpvdyqaedativqgavesnhagytgtgfvnydnvagssvewtvtvpsagtydv
    vvryangtttsrpldfsvngsisasgvafgstgtwpawttktvrvtlaagvnkikavatt
    anggpnvdkitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vzvB (B:)
    lsvgaaagnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkya
    dpfystnmqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdq
    vngaytrhdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlv
    rrsgavalrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvsla
    akerktvtfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvrdvkatl
    nssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleghiepde
    ffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerlrdhpsv
    isfhigsdfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngpydyvpp
    vywydksqkdrggawsfnsatsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssd
    tfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnpstgliy
    wmlnspwtslhwqlfdaymdqngayygakkaneplhiqyshdnrsvvvinqtsnavsglt
    attklynldgtekysntktglsvgalgakatavtvpavsglsttylaknvltdssgkevs
    rnvywlstkadtlnwggsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttv
    tlkntsggrlpafyvdskvvdsagkpvlpvewndnavslwpgetttltakyrtadlkgsk
    psvrisgwntgtqtvpad