PDB entry 2vzt

View 2vzt on RCSB PDB site
Description: complex of amycolatopsis orientalis exo-chitosanase csxa e541a with pnp-beta-d-glucosamine
Class: hydrolase
Keywords: gh2, csxa, pnp-glucosamine, glycoside hydrolase, exo-beta-d-glucosaminidase, hydrolase
Deposited on 2008-08-05, released 2008-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exo-beta-d-glucosaminidase
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VZT
      • engineered mutation (540)
      • conflict (749)
    • Uniprot Q56F26
    Domains in SCOPe 2.06: d2vzta1, d2vzta2, d2vzta3, d2vzta4, d2vzta5
  • Chain 'B':
    Compound: exo-beta-d-glucosaminidase
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VZT
      • engineered mutation (540)
      • conflict (749)
    • Uniprot Q56F26
    Domains in SCOPe 2.06: d2vztb1, d2vztb2, d2vztb3, d2vztb4, d2vztb5
  • Heterogens: CD, PNJ, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vztA (A:)
    vsfrqkrtripllamtvtalaaavcgvttapaatgaevavplsvgaaagnatpipgyviq
    ssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystnmqnvpaaqfsvp
    wwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytrhdlditaqvhtg
    vnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsgavalrsahviqklns
    aldhadltvkadvrndsanavqttvagtvagkpisqtvslaakerktvtfplvgldrpnv
    wwpagmggqhrydldltasvggtpsdaakskfgvrdvkatlnssggrqysvngkpllirg
    ggytpdlflrwnetaaadklkyvlnlglntvrleghiepdeffdiaddlgvltmpgwecc
    dkwegqvngeekgepwvesdypiakasmfseaerlrdhpsvisfhigsdfapdrrieqgy
    ldamkaadfllpvipaasarpspitgasgmkmngpydyvppvywydksqkdrggawsfns
    atsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssdtfgnlklfgdaltkrygas
    anlndfvrkaqlsqyenvraefeshsrnytdstnpstgliywmlnspwtslhwqlfdaym
    dqngayygakkaneplhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntkt
    glsvgalgakatavtvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwggsd
    wyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvdskv
    vdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvpadg
    sgpgpsdpvdyqaedativqgavesnhagytgtgfvnydnvagssvewtvtvpsagtydv
    vvryangtttsrpldfsvngsisasgvafgstgtwpawttktvrvtlaagvnkikavatt
    anggpnvdkitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vztA (A:)
    gnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystn
    mqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytr
    hdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsgava
    lrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvslaakerktv
    tfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvrdvkatlnssggrq
    ysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleghiepdeffdiadd
    lgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerlrdhpsvisfhigs
    dfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngpydyvppvywydks
    qkdrggawsfnsatsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssdtfgnlkl
    fgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnpstgliywmlnspw
    tslhwqlfdaymdqngayygakkaneplhiqyshdnrsvvvinqtsnavsgltattklyn
    ldgtekysntktglsvgalgakatavtvpavsglsttylaknvltdssgkevsrnvywls
    tkadtlnwggsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsg
    grlpafyvdskvvdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisg
    wntgtqtvpad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vztB (B:)
    vsfrqkrtripllamtvtalaaavcgvttapaatgaevavplsvgaaagnatpipgyviq
    ssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystnmqnvpaaqfsvp
    wwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytrhdlditaqvhtg
    vnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsgavalrsahviqklns
    aldhadltvkadvrndsanavqttvagtvagkpisqtvslaakerktvtfplvgldrpnv
    wwpagmggqhrydldltasvggtpsdaakskfgvrdvkatlnssggrqysvngkpllirg
    ggytpdlflrwnetaaadklkyvlnlglntvrleghiepdeffdiaddlgvltmpgwecc
    dkwegqvngeekgepwvesdypiakasmfseaerlrdhpsvisfhigsdfapdrrieqgy
    ldamkaadfllpvipaasarpspitgasgmkmngpydyvppvywydksqkdrggawsfns
    atsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssdtfgnlklfgdaltkrygas
    anlndfvrkaqlsqyenvraefeshsrnytdstnpstgliywmlnspwtslhwqlfdaym
    dqngayygakkaneplhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntkt
    glsvgalgakatavtvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwggsd
    wyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvdskv
    vdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvpadg
    sgpgpsdpvdyqaedativqgavesnhagytgtgfvnydnvagssvewtvtvpsagtydv
    vvryangtttsrpldfsvngsisasgvafgstgtwpawttktvrvtlaagvnkikavatt
    anggpnvdkitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vztB (B:)
    gnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystn
    mqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytr
    hdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsgava
    lrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvslaakerktv
    tfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvrdvkatlnssggrq
    ysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleghiepdeffdiadd
    lgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerlrdhpsvisfhigs
    dfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngpydyvppvywydks
    qkdrggawsfnsatsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssdtfgnlkl
    fgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnpstgliywmlnspw
    tslhwqlfdaymdqngayygakkaneplhiqyshdnrsvvvinqtsnavsgltattklyn
    ldgtekysntktglsvgalgakatavtvpavsglsttylaknvltdssgkevsrnvywls
    tkadtlnwggsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsg
    grlpafyvdskvvdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisg
    wntgtqtvpad