PDB entry 2vzn

View 2vzn on RCSB PDB site
Description: crystal structure of the major allergen from fire ant venom, sol I 3
Class: allergen
Keywords: major fire ant allergen, sol I 3, secreted, allergen, cross-reactivity
Deposited on 2008-08-05, released 2008-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.203
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: venom allergen 3
    Species: Solenopsis invicta [TaxId:13686]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35778 (Start-211)
    • PDB 2VZN (212-217)
    Domains in SCOPe 2.07: d2vzna1, d2vzna2
  • Chain 'B':
    Compound: venom allergen 3
    Species: Solenopsis invicta [TaxId:13686]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35778 (Start-211)
    • PDB 2VZN (212-End)
    Domains in SCOPe 2.07: d2vznb1, d2vznb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vznA (A:)
    tnycnlqsckrnnaihtmcqytsptpgpmcleysnvgftdaekdaivnkhnelrqrvasg
    kemrgtngpqppavkmpnltwdpelatiaqrwanqctfehdacrnverfavgqniaatss
    sgknkstpnemillwynevkdfdnrwissfpsddnilmkvghytqivwakttkigcgrim
    fkepdnwtkhylvcnygpagnvlgapiyeikkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vznA (A:)
    nycnlqsckrnnaihtmcqytsptpgpmcleysnvgftdaekdaivnkhnelrqrvasgk
    emrgtngpqppavkmpnltwdpelatiaqrwanqctfehdacrnverfavgqniaatsss
    gnkstpnemillwynevkdfdnrwissfpsddnilmkvghytqivwakttkigcgrimfk
    epdnwtkhylvcnygpagnvlgapiyeikkhhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vznB (B:)
    tnycnlqsckrnnaihtmcqytsptpgpmcleysnvgftdaekdaivnkhnelrqrvasg
    kemrgtngpqppavkmpnltwdpelatiaqrwanqctfehdacrnverfavgqniaatss
    sgknkstpnemillwynevkdfdnrwissfpsddnilmkvghytqivwakttkigcgrim
    fkepdnwtkhylvcnygpagnvlgapiyeikkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vznB (B:)
    nycqsaihtmcqytsptpgpmcleysnvgftdaekdaivnkhnelrqrvasgkemrgtng
    pqppavkmpnltwdpelatiaqrwanqctfehdacrnverfavgqniaatssskstpnem
    illwynevkdfdnrwissfpsddnilmkvghytqivwakttkigcgrimfkednwtkhyl
    vcnygpagnvlgapiyeikkhhhh