PDB entry 2vyr

View 2vyr on RCSB PDB site
Description: Structure of human MDM4 N-terminal domain bound to a single domain antibody
Class: immune system
Keywords: nucleus, human mdm4, immune system, zinc-finger
Deposited on 2008-07-28, released 2008-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mdm4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vyra_
  • Chain 'B':
    Compound: mdm4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vyrb_
  • Chain 'C':
    Compound: mdm4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vyrc_
  • Chain 'D':
    Compound: mdm4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vyrd_
  • Chain 'E':
    Compound: human single domain antibody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYR
    Domains in SCOPe 2.07: d2vyre_
  • Chain 'F':
    Compound: human single domain antibody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYR
    Domains in SCOPe 2.07: d2vyrf_
  • Chain 'G':
    Compound: human single domain antibody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYR
    Domains in SCOPe 2.07: d2vyrg_
  • Chain 'H':
    Compound: human single domain antibody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYR
    Domains in SCOPe 2.07: d2vyrh_
  • Chain 'I':
    Compound: human single domain antibody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYR
    Domains in SCOPe 2.07: d2vyri_
  • Chain 'J':
    Compound: human single domain antibody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYR
    Domains in SCOPe 2.07: d2vyrj_
  • Chain 'K':
    Compound: human single domain antibody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYR
    Domains in SCOPe 2.07: d2vyrk_
  • Chain 'L':
    Compound: human single domain antibody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYR
    Domains in SCOPe 2.07: d2vyrl_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vyrA (A:)
    acrispgqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvy
    cggdllgellgrqsfsvkdpsplydmlrknlvtlatattda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyrA (A:)
    nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel
    lgrqsfsvkdpsplydmlrknlvtla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vyrB (B:)
    acrispgqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvy
    cggdllgellgrqsfsvkdpsplydmlrknlvtlatattda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyrB (B:)
    nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel
    lgrqsfsvkdpsplydmlrknlvtla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vyrC (C:)
    acrispgqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvy
    cggdllgellgrqsfsvkdpsplydmlrknlvtlatattda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyrC (C:)
    nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel
    lgrqsfsvkdpsplydmlrknlvtla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vyrD (D:)
    acrispgqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvy
    cggdllgellgrqsfsvkdpsplydmlrknlvtlatattda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyrD (D:)
    nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel
    lgrqsfsvkdpsplydmlrknlvtla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vyrE (E:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvssaaaleikrasqpelapedpedvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyrE (E:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvss
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vyrF (F:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvssaaaleikrasqpelapedpedvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyrF (F:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvss
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vyrG (G:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvssaaaleikrasqpelapedpedvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyrG (G:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vyrH (H:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvssaaaleikrasqpelapedpedvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyrH (H:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvssa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2vyrI (I:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvssaaaleikrasqpelapedpedvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyrI (I:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvss
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2vyrJ (J:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvssaaaleikrasqpelapedpedvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyrJ (J:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvss
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2vyrK (K:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvssaaaleikrasqpelapedpedvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyrK (K:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2vyrL (L:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvssaaaleikrasqpelapedpedvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyrL (L:)
    evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
    adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
    tvss