PDB entry 2vxx

View 2vxx on RCSB PDB site
Description: x-ray structure of dpsa from thermosynechococcus elongatus
Class: DNA-binding protein
Keywords: stress response protein, DNA-binding protein, dps, oxidation, iron binding, ferroxidase centre
Deposited on 2008-07-14, released 2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.16739
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: starvation induced DNA binding protein
    Species: Synechococcus elongatus [TaxId:32046]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DL82 (Start-175)
    • PDB 2VXX
    Domains in SCOPe 2.06: d2vxxa_
  • Chain 'B':
    Compound: starvation induced DNA binding protein
    Species: Synechococcus elongatus [TaxId:32046]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DL82 (Start-175)
    • PDB 2VXX
    Domains in SCOPe 2.06: d2vxxb_
  • Chain 'C':
    Compound: starvation induced DNA binding protein
    Species: Synechococcus elongatus [TaxId:32046]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DL82 (Start-175)
    • PDB 2VXX
    Domains in SCOPe 2.06: d2vxxc_
  • Chain 'D':
    Compound: starvation induced DNA binding protein
    Species: Synechococcus elongatus [TaxId:32046]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DL82 (Start-175)
    • PDB 2VXX
    Domains in SCOPe 2.06: d2vxxd_
  • Heterogens: ZN, FE, PG4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vxxA (A:)
    mttsalprqafgemadtvillekatttpicegmnrllasfqalylqyqkhhfvvegaefy
    plhqffqdcyeqvqdhvhalgerlnglggvpvagfqqlaalccftpepegafncrqmlsn
    dlqaeqaiigvlrqqatqaeslgdrataylydqillkteerayhighflandslkvlkvk
    ladgrehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxxA (A:)
    alprqafgemadtvillekatttpicegmnrllasfqalylqyqkhhfvvegaefyplhq
    ffqdcyeqvqdhvhalgerlnglggvpvagfqqlaalccftpepegafncrqmlsndlqa
    eqaiigvlrqqatqaeslgdrataylydqillkteerayhighflandslkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vxxB (B:)
    mttsalprqafgemadtvillekatttpicegmnrllasfqalylqyqkhhfvvegaefy
    plhqffqdcyeqvqdhvhalgerlnglggvpvagfqqlaalccftpepegafncrqmlsn
    dlqaeqaiigvlrqqatqaeslgdrataylydqillkteerayhighflandslkvlkvk
    ladgrehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxxB (B:)
    salprqafgemadtvillekatttpicegmnrllasfqalylqyqkhhfvvegaefyplh
    qffqdcyeqvqdhvhalgerlnglggvpvagfqqlaalccftpepegafncrqmlsndlq
    aeqaiigvlrqqatqaeslgdrataylydqillkteerayhighflandslkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vxxC (C:)
    mttsalprqafgemadtvillekatttpicegmnrllasfqalylqyqkhhfvvegaefy
    plhqffqdcyeqvqdhvhalgerlnglggvpvagfqqlaalccftpepegafncrqmlsn
    dlqaeqaiigvlrqqatqaeslgdrataylydqillkteerayhighflandslkvlkvk
    ladgrehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxxC (C:)
    salprqafgemadtvillekatttpicegmnrllasfqalylqyqkhhfvvegaefyplh
    qffqdcyeqvqdhvhalgerlnglggvpvagfqqlaalccftpepegafncrqmlsndlq
    aeqaiigvlrqqatqaeslgdrataylydqillkteerayhighflandslkv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vxxD (D:)
    mttsalprqafgemadtvillekatttpicegmnrllasfqalylqyqkhhfvvegaefy
    plhqffqdcyeqvqdhvhalgerlnglggvpvagfqqlaalccftpepegafncrqmlsn
    dlqaeqaiigvlrqqatqaeslgdrataylydqillkteerayhighflandslkvlkvk
    ladgrehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxxD (D:)
    alprqafgemadtvillekatttpicegmnrllasfqalylqyqkhhfvvegaefyplhq
    ffqdcyeqvqdhvhalgerlnglggvpvagfqqlaalccftpepegafncrqmlsndlqa
    eqaiigvlrqqatqaeslgdrataylydqillkteerayhighflandslkv