PDB entry 2vxv

View 2vxv on RCSB PDB site
Description: crystal structure of human igg abt-325 fab fragment
Class: immune system
Keywords: immune system, il-18, fab, th1/th2 cells, autoimmunity
Deposited on 2008-07-10, released 2009-06-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.155
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: human igg abt-325
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXV (0-End)
  • Chain 'L':
    Compound: human igg abt-325
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXV (0-213)
    Domains in SCOPe 2.04: d2vxvl1, d2vxvl2
  • Heterogens: CXS, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vxvL (L:)
    eivmtqspatlsvspgeratlscrasesissnlawyqqkpgqaprlfiytastratdipa
    rfsgsgsgteftltisslqsedfavyycqqynnwpsitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge