PDB entry 2vxu

View 2vxu on RCSB PDB site
Description: crystal structure of murine reference antibody 125-2h fab fragment
Class: immune system
Keywords: fab, il-18, autoimmunity, th1/th2 cells, immune system
Deposited on 2008-07-10, released 2009-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.187
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: murine igg 125-2h
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXU (0-215)
  • Chain 'I':
    Compound: murine igg 125-2h
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXU (0-215)
  • Chain 'L':
    Compound: murine igg 125-2h
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXU (0-213)
    Domains in SCOPe 2.06: d2vxul1, d2vxul2
  • Chain 'M':
    Compound: murine igg 125-2h
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXU (0-213)
    Domains in SCOPe 2.06: d2vxum1, d2vxum2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vxuL (L:)
    diqmtqspsslsaslgervsltcrasqdigsklywlqqepdgtfkrliyatssldsgvpk
    rfsgsrsgsdysltisslesedfvdyyclqyasspytfgggtklaikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vxuM (M:)
    diqmtqspsslsaslgervsltcrasqdigsklywlqqepdgtfkrliyatssldsgvpk
    rfsgsrsgsdysltisslesedfvdyyclqyasspytfgggtklaikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec