PDB entry 2vxt

View 2vxt on RCSB PDB site
Description: crystal structure of human il-18 complexed to murine reference antibody 125-2h fab
Class: cytokine
Keywords: fab, il-18, secreted, cytokine, autoimmunity, glycoprotein, th1/th2 cells, immunoglobulin domain, immunoglobulin v region
Deposited on 2008-07-10, released 2009-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.164
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: murine igg 125-2h
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXT (0-End)
  • Chain 'I':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14116 (0-End)
      • engineered mutation (37)
      • engineered mutation (67)
      • engineered mutation (75)
      • engineered mutation (126)
    Domains in SCOPe 2.06: d2vxti_
  • Chain 'L':
    Compound: murine igg 125-2h
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXT (0-End)
    Domains in SCOPe 2.06: d2vxtl1, d2vxtl2
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2vxtI (I:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdardnaprtifiismykdsqprgm
    avtisvkaekistlsaenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflaaekerdlfklilkkedelgdrsimftvqned
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxtI (I:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdardnaprtifiismykdsqprgm
    avtisvkaekistlsaenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflaaekerdlfklilkkedelgdrsimftvqne
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2vxtL (L:)
    diqmtqspsslsaslgervsltcrasqdigsklywlqqepdgtfkrliyatssldsgvpk
    rfsgsrsgsdysltisslesedfvdyyclqyasspytfgggtklaikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxtL (L:)
    diqmtqspsslsaslgervsltcrasqdigsklywlqqepdgtfkrliyatssldsgvpk
    rfsgsrsgsdysltisslesedfvdyyclqyasspytfgggtklaikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne