PDB entry 2vxq

View 2vxq on RCSB PDB site
Description: crystal structure of the major grass pollen allergen phl p 2 in complex with its specific ige-fab
Class: allergen
Keywords: receptor, secreted, rphl p 2, allergen, allergen-ige fab complex, recombinant grass pollen allergen
Deposited on 2008-07-08, released 2009-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pollen allergen phl p 2
    Species: PHLEUM PRATENSE [TaxId:15957]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxqa_
  • Chain 'H':
    Compound: fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXQ (0-215)
  • Chain 'L':
    Compound: fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXQ (0-End)
    Domains in SCOPe 2.07: d2vxql1, d2vxql2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vxqA (A:)
    vpkvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseepl
    qgpfnfrfltekgmknvfddvvpekytigatyapee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxqA (A:)
    kvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseeplqg
    pfnfrfltekgmknvfddvvpekytigatyap
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2vxqL (L:)
    eiemtqspsslsasvgdrvtiscrasqrintylnwyqhkpgkapklliyaasslqsgvps
    rfsgsgygtdftltisslqpedfasyycqeslsasytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxqL (L:)
    eiemtqspsslsasvgdrvtiscrasqrintylnwyqhkpgkapklliyaasslqsgvps
    rfsgsgygtdftltisslqpedfasyycqeslsasytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge