PDB entry 2vxi

View 2vxi on RCSB PDB site
Description: the binding of heme and zinc in escherichia coli bacterioferritin
Class: metal transport
Keywords: metal transport, bacterioferritin, iron storage and electron transport, zinc, heme, iron, iron storage, metal-binding
Deposited on 2008-07-04, released 2008-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.17925
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxia_
  • Chain 'B':
    Compound: bacterioferritin
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxib_
  • Chain 'C':
    Compound: bacterioferritin
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxic_
  • Chain 'D':
    Compound: bacterioferritin
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxid_
  • Chain 'E':
    Compound: bacterioferritin
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxie_
  • Chain 'F':
    Compound: bacterioferritin
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxif_
  • Chain 'G':
    Compound: bacterioferritin
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxig_
  • Chain 'H':
    Compound: bacterioferritin
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxih_
  • Chain 'I':
    Compound: bacterioferritin
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxii_
  • Chain 'J':
    Compound: bacterioferritin
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxij_
  • Chain 'K':
    Compound: bacterioferritin
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxik_
  • Chain 'L':
    Compound: bacterioferritin
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vxil_
  • Heterogens: HEM, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vxiA (A:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxiA (A:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqiree
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vxiB (B:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxiB (B:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqiree
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vxiC (C:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxiC (C:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqiree
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vxiD (D:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxiD (D:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqiree
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vxiE (E:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxiE (E:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqiree
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vxiF (F:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxiF (F:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqiree
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vxiG (G:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxiG (G:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqiree
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vxiH (H:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxiH (H:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqiree
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2vxiI (I:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxiI (I:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqiree
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2vxiJ (J:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxiJ (J:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqiree
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2vxiK (K:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxiK (K:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqiree
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2vxiL (L:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxiL (L:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqiree