PDB entry 2vx5

View 2vx5 on RCSB PDB site
Description: cellvibrio japonicus mannanase cjman26c mannose-bound form
Class: hydrolase
Keywords: cellvibrio japonicus, mannanase, cjman26c, hydrolase
Deposited on 2008-07-01, released 2008-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-12-09, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.15136
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellvibrio japonicus mannanase cjman26c
    Species: CELLVIBRIO JAPONICUS [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VX5 (Start-395)
    Domains in SCOPe 2.06: d2vx5a_
  • Heterogens: BMA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vx5A (A:)
    msekpaesaaavadsatttapqsgkpetalpalidtqataetralyrnlaklrykhllfg
    hedslaygvhwegdmdrsdvrdvtganpavygwelgglelghtanldavnfekmqhwika
    gysrggvitiswhvfnpvsggnswdktpavhelipggarhatlkayldtfvafnegladv
    daqgnkhyppiifrpwhehngdwfwwgkghaseqdyialwrftvhylrdekklrnliyay
    spdrsridmanfeagylygypgdayvdiigldnywdvgheantasadeqkaaltaslkql
    vqiarskgkiaaltetgnnrltidnfwterllgpisadadaseiayvmvwrnanlareks
    eqffapfpgqataddfkrfyqsevvlfedelpplyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vx5A (A:)
    lpalidtqataetralyrnlaklrykhllfghedslaygvhwegdmdrsdvrdvtganpa
    vygwelgglelghtanldavnfekmqhwikagysrggvitiswhvfnpvsggnswdktpa
    vhelipggarhatlkayldtfvafnegladvdaqgnkhyppiifrpwhehngdwfwwgkg
    haseqdyialwrftvhylrdekklrnliyayspdrsridmanfeagylygypgdayvdii
    gldnywdvgheantasadeqkaaltaslkqlvqiarskgkiaaltetgnnrltidnfwte
    rllgpisadadaseiayvmvwrnanlarekseqffapfpgqataddfkrfyqsevvlfed
    elpplyr