PDB entry 2vwj

View 2vwj on RCSB PDB site
Description: uracil recognition in archaeal DNA polymerases captured by x-ray crystallography.
Class: DNA replication
Keywords: DNA replication, multifunctional enzyme, nucleotidyltransferase, DNA-directed DNA polymerase, transferase, exonuclease, DNA-binding, DNA polymerase, uracil, archaea, nuclease, hydrolase, DNA repair
Deposited on 2008-06-25, released 2008-07-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Thermococcus gorgonarius [TaxId:71997]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56689 (0-End)
      • conflict (150)
      • conflict (173)
      • engineered mutation (214)
    Domains in SCOPe 2.04: d2vwja1, d2vwja2
  • Chain 'B':
    Compound: 5'-d(*ap*ap*up*gp*gp*ap*gp*ap*cp*gp *gp*cp*tp*tp*tp*tp*gp*cp*cp*gp*tp*gp*tp*c)-3'
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vwjA (A:)
    mildtdyitedgkpvirifkkengefkidydrnfepyiyallkddsaiedvkkitaerhg
    ttvrvvraekvkkkflgrpievwklyfthpqdvpairdkikehpavvdiyeydipfakry
    lidkglipmegdeelkmlafdietlyhegekfaegpilmisyadeegarvitwrnidlpy
    vdvvstekemikrflkvvkekdpdvlityngdnfafaylkkrseklgvkfilgregsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeaifgqpkekvyaeeiaqawe
    tgeglervarysmedakvtyelgkeffpmeaqlsrlvgqslwdvsrsstgnlvewfllrk
    ayernelapnkpderelarrresyaggyvkeperglwenivyldfrslypsiiithnvsp
    dtlnregceeydvapqvghkfckdfpgfipsllgdlleerqkvkkkmkatidpiekklld
    yrqraikilansfygyygyakarwyckecaesvtawgrqyiettireieekfgfkvlyad
    tdgffatipgadaetvkkkakefldyinaklpglleleyegfykrgffvtkkkyavidee
    dkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevteklskyevppekl
    viyeqitrdlkdykatgphvavakrlaargikirpgtvisyivlkgsgrigdraipfdef
    dpakhkydaeyyienqvlpaverilrafgyrkedlryqktrqvglgawlkpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vwjA (A:)
    mildtdyitedgkpvirifkkengefkidydrnfepyiyallkddsaiedvkkitaerhg
    ttvrvvraekvkkkflgrpievwklyfthpqdvpairdkikehpavvdiyeydipfakry
    lidkglipmegdeelkmlafdietlyhegekfaegpilmisyadeegarvitwrnidlpy
    vdvvstekemikrflkvvkekdpdvlityngdnfafaylkkrseklgvkfilgregsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeaifgqpkekvyaeeiaqawe
    tgeglervarysmedakvtyelgkeffpmeaqlsrlvgqslwdvsrsstgnlvewfllrk
    ayernelapnkpderelarrresyaggyvkeperglwenivyldfrslypsiiithnvsp
    dtlnregceeydvapqvghkfckdfpgfipsllgdlleerqkvkkkmkatidpiekklld
    yrqraikilansfygyygyakarwyckecaesvtawgrqyiettireieekfgfkvlyad
    tdgffatipgadaetvkkkakefldyinaklpglleleyegfykrgffvtkkkyavidee
    dkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevteklskyevppekl
    viyeqitrdlkdykatgphvavakrlaargikirpgtvisyivlkgsgrigdraipfdef
    dpakhkydaeyyienqvlpaverilrafgyrkedlry
    

  • Chain 'B':
    No sequence available.