PDB entry 2vv1

View 2vv1 on RCSB PDB site
Description: hPPARgamma Ligand binding domain in complex with 4-HDHA
Class: receptor
Keywords: transcription regulation, ligand binding domain, nuclear receptor, diabetes mellitus, zinc-finger, DNA-binding, transcription, obesity, nucleus, receptor, activator, oxidised fatty acid, transcription factor, metal-binding, phosphoprotein, disease mutation
Deposited on 2008-06-02, released 2008-08-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.239
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vv1a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VV1
      • conflict (7)
    • Uniprot P37231
    Domains in SCOPe 2.06: d2vv1b_
  • Heterogens: 4HD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vv1A (A:)
    galnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
    ikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkyg
    vheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldd
    sdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtd
    lrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vv1A (A:)
    pesadlralakhlydsyiksfpltkakarailtgttdkspfviydmnslmmgedkievai
    rifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgv
    lisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpg
    llnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkt
    etdmslhpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vv1B (B:)
    galnpessdlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
    ikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkyg
    vheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldd
    sdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtd
    lrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vv1B (B:)
    sdlralakhlydsyiksfpltkakarailtgkdkspfviydmnslmmgevairifqgcqf
    rsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgf
    mtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpie
    diqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktpllqeiy