PDB entry 2vux

View 2vux on RCSB PDB site
Description: human ribonucleotide reductase, subunit m2 b
Class: oxidoreductase
Keywords: DNA replication, de novo pathway, nucleotide metabolism, ribonucleotide reductase, rnr, iron, p53r2, casp8, nucleus, metal-binding, oxidoreductase, DNA damage, DNA repair, iron binding, subunit m2 b
Deposited on 2008-05-31, released 2008-07-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleoside-diphosphate reductase subunit m2 b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2vuxa_
  • Chain 'B':
    Compound: ribonucleoside-diphosphate reductase subunit m2 b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2vuxb_
  • Heterogens: FE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vuxA (A:)
    mhhhhhhssgvdlgtenlyfqsmsdtneseiksneepllrkssrrfvifpiqypdiwkmy
    kqaqasfwtaeevdlskdlphwnklkadekyfishilaffaasdgivnenlverfsqevq
    vpearcfygfqilienvhsemysllidtyirdpkkreflfnaietmpyvkkkadwalrwi
    adrkstfgervvafaavegvffsgsfaaifwlkkrglmpgltfsnelisrdeglhcdfac
    lmfqylvnkpseervreiivdavkieqefltealpvgligmncilmkqyiefvadrllve
    lgfskvfqaenpfdfmenislegktn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuxA (A:)
    neepllrkvifpiqypdiwkmykqaqasfwtaeevdlskdlphwnklkadekyfishila
    ffaasnlverfsqevqvpearcfygfqilienvhsemysllidtyirdpkkreflfnaie
    tmpyvkkkadwalrwiadrkstfgervvafaavegvffsgsfaaifwlkkrglmpgltfs
    nelisrdeglhcdfaclmfqylvnkpseervreiivdavkieqefltealpvgligmnci
    lmkqyiefvadrllvelgfskvfqaenpfdfm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vuxB (B:)
    mhhhhhhssgvdlgtenlyfqsmsdtneseiksneepllrkssrrfvifpiqypdiwkmy
    kqaqasfwtaeevdlskdlphwnklkadekyfishilaffaasdgivnenlverfsqevq
    vpearcfygfqilienvhsemysllidtyirdpkkreflfnaietmpyvkkkadwalrwi
    adrkstfgervvafaavegvffsgsfaaifwlkkrglmpgltfsnelisrdeglhcdfac
    lmfqylvnkpseervreiivdavkieqefltealpvgligmncilmkqyiefvadrllve
    lgfskvfqaenpfdfmenislegktn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuxB (B:)
    eepllrkrfvifpiqypdiwkmykqaqasfwtaeevdlskdlphwnklkadekyfishil
    affanenlverfsqevqvpearcfygfqilienvhsemysllidtyirdpkkrpyvkkka
    dwtfgervvafaavegvffsgsfaaifwlkkrglmpgltfsnelisrdeglhcdfaclmf
    qylvnkpseervreiivdavkieqefltealpvgligmncilmkqyiefvadrllvelgf
    skvfqaenpfdfmen