PDB entry 2vua

View 2vua on RCSB PDB site
Description: crystal structure of the botulinum neurotoxin serotype a binding domain
Class: hydrolase
Keywords: ganglioside, receptor, toxin, membrane, secreted, metal-binding, hydrolase, metalloprotease, neurotoxin, protease
Deposited on 2008-05-22, released 2008-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: botulinum neurotoxin a heavy chain
    Species: CLOSTRIDIUM BOTULINUM [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VUA (443-443)
    • Uniprot P10845 (22-442)
    Domains in SCOPe 2.06: d2vuaa1, d2vuaa2, d2vuaa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vuaA (A:)
    mgsshhhhhhssglvprgshmdtsilnlryesnhlidlsryaskinigskvnfdpidknq
    iqlfnlesskievilknaivynsmyenfstsfwiripkyfnsislnneytiincmennsg
    wkvslnygeiiwtlqdtqeikqrvvfkysqminisdyinrwifvtitnnrlnnskiying
    rlidqkpisnlgnihasnnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsn
    sgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnss
    lyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipd
    vgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqier
    ssrtlgcswefipvddgwgerplq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuaA (A:)
    hmdtsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknai
    vynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqe
    ikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnn
    imfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqydkpyy
    mlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgtkfiikkyasgnkdn
    ivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmksknditnk
    ckmnlqdnngndigfigfhqfnniaklvasnwynrqierssrtlgcswefipvddgwger
    plq