PDB entry 2vso

View 2vso on RCSB PDB site
Description: crystal structure of a translation initiation complex
Class: hydrolase/translation
Keywords: acetylation, ATP-binding, phosphoprotein, protein biosynthesis, translation regulation, translation initiation, hydrolase/translation, initiation factor, nucleotide-binding, helicase, hydrolase, cytoplasm, RNA-binding
Deposited on 2008-04-28, released 2008-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2154
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase eif4a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vsoa1, d2vsoa2
  • Chain 'B':
    Compound: ATP-dependent RNA helicase eif4a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vsob1, d2vsob2
  • Chain 'E':
    Compound: Eukaryotic initiation factor 4F subunit p150
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Eukaryotic initiation factor 4F subunit p150
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vsoA (A:)
    msegitdieesqiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiiegh
    dvlaqaqsgtgktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdik
    vhaciggtsfvedaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgf
    keqiyqiftllppttqvvllsatmpndvlevttkfmrnpvrilvkkdeltlegikqfyvn
    veeeeykyecltdlydsisvtqavifcntrrkveelttklrndkftvsaiysdlpqqerd
    timkefrsgssrilistdllargidvqqvslvinydlpankenyihrigrggrfgrkgva
    infvtnedvgamrelekfystqieelpsdiatlln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vsoA (A:)
    qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
    ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciglrdaq
    ivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftllppttqvvlls
    atmpndvlevttkfmrnpvrilvkkdeltlegikqfyvnveeeeykyecltdlydsisvt
    qavifcntrrkveelttklrndkftvsaiysdlpqqerdtimkefrsgssrilistdlla
    rgidvqqvslvinydlpankenyihrigrkgvainfvtnedvgamrelekfystqieelp
    sdiatl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vsoB (B:)
    msegitdieesqiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiiegh
    dvlaqaqsgtgktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdik
    vhaciggtsfvedaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgf
    keqiyqiftllppttqvvllsatmpndvlevttkfmrnpvrilvkkdeltlegikqfyvn
    veeeeykyecltdlydsisvtqavifcntrrkveelttklrndkftvsaiysdlpqqerd
    timkefrsgssrilistdllargidvqqvslvinydlpankenyihrigrggrfgrkgva
    infvtnedvgamrelekfystqieelpsdiatlln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vsoB (B:)
    qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
    ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciglrdaq
    ivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftllppttqvvlls
    atmpndvlevttkfmrnpvrilvkkdeltlegikqfyvnveeeeykyecltdlydsisvt
    qavifcntrrkveelttklrndkftvsaiysdlpqqerdtimkefrsgssrilistdlla
    rgidvqqvslvinydlpankenyihrigrkgvainfvtnedvgamrelekfystqieelp
    sdiatl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.