PDB entry 2vqd

View 2vqd on RCSB PDB site
Description: crystal structure of biotin carboxylase from pseudomonas aeruginosa complexed with ampcp
Class: ligase
Keywords: nucleotide-binding, fatty acid biosynthesis, lipid synthesis, ATP-grasp domain, biotin carboxylase, ligase, biotin, bacteria, ATP-binding
Deposited on 2008-03-13, released 2008-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.182
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin carboxylase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37798 (0-End)
    • PDB 2VQD
    Domains in SCOPe 2.06: d2vqda1, d2vqda2, d2vqda3
  • Heterogens: AP2, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vqdA (A:)
    mlekvlianrgeialrilrackelgiktvavhstadrelmhlsladesvcigpapatqsy
    lqipaiiaaaevtgataihpgygflaenadfaeqiersgftfvgptaevirlmgdkvsak
    damkragvptvpgsdgplpedeetalaiarevgypviikaagggggrgmrvvydeselik
    sakltrteagaafgnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqrrhqkvi
    eeapapgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvqvehpvs
    emvtgvdivkemlriasgeklsirqedvvirghalecrinaedpktfmpspgkvkhfhap
    ggngvrvdshlysgysvppnydslvgkvitygadrdealarmrnaldelivdgiktntel
    hkdlvrdaafckggvnihylekklgmdkhgsenlyfqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vqdA (A:)
    mlekvlianrgeialrilrackelgiktvavhstadrelmhlsladesvcigpapatqsy
    lqipaiiaaaevtgataihpgygflaenadfaeqiersgftfvgptaevirlmgdkvsak
    damkragvptvpgsdgplpedeetalaiarevgypviikaagggggrgmrvvydeselik
    sakltrteagaafgnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqrrhqkvi
    eeapapgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvqvehpvs
    emvtgvdivkemlriasgeklsirqedvvirghalecrinaedpktfmpspgkvkhfhap
    ggngvrvdshlysgysvppnydslvgkvitygadrdealarmrnaldelivdgiktntel
    hkdlvrdaafckggvnihylekklgmd