PDB entry 2vq1

View 2vq1 on RCSB PDB site
Description: anti trimeric lewis x fab54-5c10-a
Class: immune system
Keywords: monoclonal antibody, receptor, diagnosis, schistosomiasis, carbohydrate recognition, immune system
Deposited on 2008-03-10, released 2009-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igkv1-117 protein
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VQ1 (0-216)
    Domains in SCOPe 2.07: d2vq1a1, d2vq1a2
  • Chain 'B':
    Compound: anti-human fc gamma receptor III 3g8 gamma heavy chain variable region
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VQ1 (0-217)
  • Chain 'E':
    Compound: igkv1-117 protein
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VQ1 (0-216)
    Domains in SCOPe 2.07: d2vq1e1, d2vq1e2
  • Chain 'F':
    Compound: anti-human fc gamma receptor III 3g8 gamma heavy chain variable region
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VQ1 (0-217)
  • Heterogens: GLY, GOL, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vq1A (A:)
    dvvmtqtplslsvslgdqasiscrssqslvhsngntflqwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrmeaedlgiyfcsqtthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vq1E (E:)
    dvvmtqtplslsvslgdqasiscrssqslvhsngntflqwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrmeaedlgiyfcsqtthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'F':
    No sequence available.