PDB entry 2vpq

View 2vpq on RCSB PDB site
Description: crystal structure of biotin carboxylase from s. aureus complexed with amppnp
Class: ligase
Keywords: bacteria, ATP-grasp domain, biotin carboxylase, ligase
Deposited on 2008-03-03, released 2008-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coa carboxylase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vpqa1, d2vpqa2, d2vpqa3
  • Chain 'B':
    Compound: acetyl-coa carboxylase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vpqb1, d2vpqb2, d2vpqb3
  • Heterogens: ANP, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vpqA (A:)
    mkkvlianrgeiavriiracrdlgiqtvaiysegdkdalhtqiadeaycvgptlskdsyl
    nipnilsiatstgcdgvhpgygflaenadfaelceacqlkfigpsyqsiqkmgikdvaka
    emikanvpvvpgsdglmkdvseakkiakkigypviikataggggkgirvardekeletgf
    rmteqeaqtafgngglymekfienfrhieiqivgdsygnvihlgerdctiqrrmqklvee
    apspilddetrremgnaavraakavnyenagtiefiydlndnkfyfmemntriqvehpvt
    emvtgidlvklqlqvamgdvlpykqedikltghaiefrinaenpyknfmpspgkieqyla
    pggygvriesacytnytippyydsmvakliiheptrdeaimagiralsefvvlgidttip
    fhikllnndifrsgkfntnfleqnsimndeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vpqA (A:)
    kkvlianrgeiavriiracrdlgiqtvaiysegdkdalhtqiadeaycvgptlskdsyln
    ipnilsiatstgcdgvhpgygflaenadfaelceacqlkfigpsyqsiqkmgikdvakae
    mikanvpvvpgsdglmkdvseakkiakkigypviikataggggkgirvardekeletgfr
    mteqeaqtafgngglymekfienfrhieiqivgdsygnvihlgerdctiqrrmqklveea
    pspilddetrremgnaavraakavnyenagtiefiydlndnkfyfmemntriqvehpvte
    mvtgidlvklqlqvamgdvlpykqedikltghaiefrinaenpyknfmpspgkieqylap
    ggygvriesacytnytippyydsmvakliiheptrdeaimagiralsefvvlgidttipf
    hikllnndifrsgkfntnfleqnsimn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vpqB (B:)
    mkkvlianrgeiavriiracrdlgiqtvaiysegdkdalhtqiadeaycvgptlskdsyl
    nipnilsiatstgcdgvhpgygflaenadfaelceacqlkfigpsyqsiqkmgikdvaka
    emikanvpvvpgsdglmkdvseakkiakkigypviikataggggkgirvardekeletgf
    rmteqeaqtafgngglymekfienfrhieiqivgdsygnvihlgerdctiqrrmqklvee
    apspilddetrremgnaavraakavnyenagtiefiydlndnkfyfmemntriqvehpvt
    emvtgidlvklqlqvamgdvlpykqedikltghaiefrinaenpyknfmpspgkieqyla
    pggygvriesacytnytippyydsmvakliiheptrdeaimagiralsefvvlgidttip
    fhikllnndifrsgkfntnfleqnsimndeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vpqB (B:)
    kkvlianrgeiavriiracrdlgiqtvaiysegdkdalhtqiadeaycvgptlskdsyln
    ipnilsiatstgcdgvhpgygflaenadfaelceacqlkfigpsyqsiqkmgikdvakae
    mikanvpvvpgsdglmkdvseakkiakkigypviikataggggkgirvardekeletgfr
    mteqeaqtafgngglymekfienfrhieiqivgdsygnvihlgerdctiqrrmqklveea
    pspilddetrremgnaavraakavnyenagtiefiydlndnkfyfmemntriqvehpvte
    mvtgidlvklqlqvamgdvlpykqedikltghaiefrinaenpyknfmpspgkieqylap
    ggygvriesacytnytippyydsmvakliiheptrdeaimagiralsefvvlgidttipf
    hikllnndifrsgkfntnfleqnsimnd