PDB entry 2vop

View 2vop on RCSB PDB site
Description: crystal structure of n-terminal domains of human la protein complexed with RNA oligomer auuuu
Class: RNA-binding protein
Keywords: RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation, RNA binding protein, nucleus, la motif, RNA-binding, polymorphism
Deposited on 2008-02-19, released 2008-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.261
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lupus La protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vopa1, d2vopa2
  • Chain 'B':
    Compound: 5'-r(*ap*up*up*up*up)-3'
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vopA (A:)
    gsngdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrl
    ttdfnvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptd
    atlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdll
    ilfkddyfakkne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vopA (A:)
    ekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdfnv
    ivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptdatlddi
    kewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdllilfkdd
    yfak
    

  • Chain 'B':
    No sequence available.