PDB entry 2vnf

View 2vnf on RCSB PDB site
Description: molecular basis of histone h3k4me3 recognition by ing4
Class: cell cycle
Keywords: anti-oncogene, cell cycle, coiled c nucleus, zinc-finger, ing4, phd finger, histone 3
Deposited on 2008-02-04, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inhibitor of growth protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vnfa_
  • Chain 'B':
    Compound: histone h3
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Inhibitor of growth protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vnfc_
  • Chain 'D':
    Compound: histone h3
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, DTT, ZN, DTU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vnfA (A:)
    mdmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqer
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vnfA (A:)
    eptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vnfC (C:)
    mdmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqer
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vnfC (C:)
    vdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq
    

  • Chain 'D':
    No sequence available.