PDB entry 2vm0

View 2vm0 on RCSB PDB site
Description: crystal structure of radiation-induced myoglobin compound II generated after annealing of peroxymyoglobin
Class: oxygen transport
Keywords: haem, iron, heme, ferryl, transport, peroxidase, oxygen transport, oxygen activation, radiolytic- reduction, reaction intermediate, monooxygenase, metal-binding, muscle protein, x-ray-induced-photoreduction
Deposited on 2008-01-20, released 2008-01-29
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-01, with a file datestamp of 2008-03-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.16451
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: EQUUS CABALLUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68082 (0-152)
  Domains in SCOP 1.75: d2vm0a1
• Heterogens: SO4, HEM, HYD, PEO, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2vm0A (A:)
  glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
  lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
  gdfgadaqgamtkalelfrndiaakykelgfqg