PDB entry 2vjx

View 2vjx on RCSB PDB site
Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
Class: hydrolase
Keywords: linear free energy relationship, hydrolase, transition state mimic, mannosidase, glycoside hydrolase
Deposited on 2007-12-14, released 2008-04-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.162
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-mannosidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AAK6 (Start-838)
    • PDB 2VJX
    Domains in SCOPe 2.04: d2vjxa1, d2vjxa2, d2vjxa3, d2vjxa4, d2vjxa5
  • Chain 'B':
    Compound: beta-mannosidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AAK6 (Start-838)
    • PDB 2VJX (839-End)
    Domains in SCOPe 2.04: d2vjxb1, d2vjxb2, d2vjxb3, d2vjxb4, d2vjxb5
  • Heterogens: IFL, EDO, BR, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vjxA (A:)
    qgndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwve
    nedweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvl
    rkgenhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmv
    tsgvwrpvtlrfydiatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvsln
    gttvtevkqqvtlqpginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqs
    hriglrtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmk
    eanmnmvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavyni
    rrlrnhaslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefds
    drfyvhsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemk
    tiaafaapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgm
    rhgleahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafapvlinpiq
    qndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcvyrakldg
    wltpedcrrsflklilkdksghqvaesvhffrktkdlqlpptsvsyqmkqtdgkceltlf
    ssmlakdifietplqgarysdnffdllpgerkkviitsprikkgeelpvnikhiretyke
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vjxA (A:)
    ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
    dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
    genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
    gvwrpvtlrfydiatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngt
    tvtevkqqvtlqpginhitlpaevtnpvrwmpngwgtptlydfsaqiacgrivaeqshri
    glrtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkean
    mnmvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrl
    rnhaslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrf
    yvhsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktia
    afaapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhg
    leahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafapvlinpiqqnd
    slsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcvyrakldgwlt
    pedcrrsflklilkdksghqvaesvhffrktkdlqlpptsvsyqmkqtdgkceltlfssm
    lakdifietplqgarysdnffdllpgerkkviitsprikkgeelpvnikhiretyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vjxB (B:)
    qgndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwve
    nedweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvl
    rkgenhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmv
    tsgvwrpvtlrfydiatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvsln
    gttvtevkqqvtlqpginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqs
    hriglrtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmk
    eanmnmvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavyni
    rrlrnhaslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefds
    drfyvhsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemk
    tiaafaapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgm
    rhgleahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafapvlinpiq
    qndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcvyrakldg
    wltpedcrrsflklilkdksghqvaesvhffrktkdlqlpptsvsyqmkqtdgkceltlf
    ssmlakdifietplqgarysdnffdllpgerkkviitsprikkgeelpvnikhiretyke
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vjxB (B:)
    ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
    dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
    genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
    gvwrpvtlrfydiatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngt
    tvtevkqqvtlqpginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshr
    iglrtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkea
    nmnmvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirr
    lrnhaslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdr
    fyvhsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemkti
    aafaapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrh
    gleahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafapvlinpiqqn
    dslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcvyrakldgwl
    tpedcrrsflklilkdksghqvaesvhffrktkdlqlpptsvsyqmkqtdgkceltlfss
    mlakdifietplqgarysdnffdllpgerkkviitsprikkgeelpvnikhiretykeh