PDB entry 2vjg

View 2vjg on RCSB PDB site
Description: crystal structure of the major carrot allergen dau c 1
Class: allergen
Keywords: major carrot allergen, pathogenesis-related protein, dau c 1, allergen, plant defense
Deposited on 2007-12-10, released 2008-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.188
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major allergen dau c 1
    Species: DAUCUS CAROTA [TaxId:4039]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04298 (Start-153)
      • variant (35)
      • variant (65)
      • variant (79)
      • variant (101)
    Domains in SCOPe 2.06: d2vjga_
  • Chain 'B':
    Compound: major allergen dau c 1
    Species: DAUCUS CAROTA [TaxId:4039]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04298 (Start-153)
      • variant (35)
      • variant (65)
      • variant (79)
      • variant (101)
    Domains in SCOPe 2.06: d2vjgb_
  • Chain 'C':
    Compound: major allergen dau c 1
    Species: DAUCUS CAROTA [TaxId:4039]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04298 (Start-153)
      • variant (35)
      • variant (65)
      • variant (79)
      • variant (101)
    Domains in SCOPe 2.06: d2vjgc_
  • Chain 'D':
    Compound: major allergen dau c 1
    Species: DAUCUS CAROTA [TaxId:4039]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04298 (Start-153)
      • variant (35)
      • variant (65)
      • variant (79)
      • variant (101)
    Domains in SCOPe 2.06: d2vjgd_
  • Heterogens: P4C, PEG, PGE, EDO, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vjgA (A:)
    mgaqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpe
    gspittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaif
    htkgdavvpeenikfadaqntalfkaieaylian
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vjgA (A:)
    aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
    pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
    kgdavvpeenikfadaqntalfkaieaylian
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vjgB (B:)
    mgaqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpe
    gspittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaif
    htkgdavvpeenikfadaqntalfkaieaylian
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vjgB (B:)
    aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
    pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
    kgdavvpeenikfadaqntalfkaieaylian
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vjgC (C:)
    mgaqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpe
    gspittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaif
    htkgdavvpeenikfadaqntalfkaieaylian
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vjgC (C:)
    aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
    pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
    kgdavvpeenikfadaqntalfkaieaylian
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vjgD (D:)
    mgaqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpe
    gspittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaif
    htkgdavvpeenikfadaqntalfkaieaylian
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vjgD (D:)
    aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
    pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
    kgdavvpeenikfadaqntalfkaieaylian