PDB entry 2vjd

View 2vjd on RCSB PDB site
Description: torpedo californica acetylcholinesterase in complex with a non hydrolysable substrate analogue, 4-oxo-n,n,n-trimethylpentanaminium - orthorhombic space group -dataset c at 150k
Class: hydrolase
Keywords: serine esterase, alternative splicing, neurotransmitter degradation, kinetic crystallography, structural dynamics, xray damage, substrate analogue, lipoprotein, glycoprotein, cell junction, synapse, membrane, hydrolase, gpi-anchor
Deposited on 2007-12-09, released 2008-07-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Torpedo californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2vjda_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Torpedo californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2vjdb_
  • Heterogens: NAG, CL, CCD, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vjdA (A:)
    ddhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwna
    stypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggf
    ysgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwv
    hdniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvae
    grrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgef
    fptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsv
    phandlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyl
    yffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktg
    npnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnatac
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vjdA (A:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    epskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vjdB (B:)
    ddhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwna
    stypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggf
    ysgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwv
    hdniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvae
    grrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgef
    fptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsv
    phandlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyl
    yffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktg
    npnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnatac
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vjdB (B:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat