PDB entry 2vis

View 2vis on RCSB PDB site
Description: influenza virus hemagglutinin, (escape) mutant with thr 131 replaced by ile, complexed with a neutralizing antibody
Deposited on 1997-12-22, released 1998-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.188
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2visA (A:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtveksls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2visB (B:)
    qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn
    salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2visC (C:)
    vqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydv
    pdyaslrslvassgtlefitegftwtgviqnggsnackrgpgsgffsrlnwltksgstyp
    vlnvtmpnndnfdklyiwgihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpw
    vrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtciseci
    tpngsipndkpfqnvnkitygacpkyv