PDB entry 2vil

View 2vil on RCSB PDB site
Description: refined structure of the actin-severing domain villin 14t, determined by solution nmr, 11 structures
Class: actin-binding protein
Keywords: actin-binding protein, capping protein, calcium-binding protein, cytoskeletal protein
Deposited on 1997-01-16, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: villin 14t
    Species: Gallus gallus [TaxId:9031]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2vila_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2vilA (A:)
velskkvtgkldkttpgiqiwrienmemvpvptksygnfyegdcyvllstrktgsgfsyn
ihywlgknssqdeqgaaaiyttqmdeylgsvavqhrevqghesetfrayfkqgliykqgg
vasgmk