SCOPe 2.04: Structural Classification of Proteins

PDB entry 2vig

View 2vig on RCSB PDB site
Description: crystal structure of human short-chain acyl coa dehydrogenase
Class: oxidoreductase
Keywords: fatty acid metabolism, fad, polymorphism, flavoprotein, mitochondrion, disease mutation, lipid metabolism, oxidoreductase, beta oxidation, transit peptide
Deposited on 2007-11-30, released 2007-12-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: short-chain specific acyl-coa dehydrogenase,
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2VIG
  - conflict see remark 9 (180)
- Uniprot P16219 (Start-383)
Domains in SCOPe 2.04: d2viga1, d2viga2
Chain 'B':
Compound: short-chain specific acyl-coa dehydrogenase,
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2VIG
  - conflict see remark 9 (180)
- Uniprot P16219
Domains in SCOPe 2.04: d2vigb1, d2vigb2
Chain 'C':
Compound: short-chain specific acyl-coa dehydrogenase,
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2VIG (384-End)
  - conflict see remark 9 (180)
- Uniprot P16219 (Start-383)
Domains in SCOPe 2.04: d2vigc1, d2vigc2
Chain 'D':
Compound: short-chain specific acyl-coa dehydrogenase,
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2VIG (384-End)
  - conflict see remark 9 (180)
- Uniprot P16219 (Start-383)
Domains in SCOPe 2.04: d2vigd1, d2vigd2
Chain 'E':
Compound: short-chain specific acyl-coa dehydrogenase,
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2VIG (384-End)
  - conflict see remark 9 (180)
- Uniprot P16219 (Start-383)
Domains in SCOPe 2.04: d2vige1, d2vige2
Chain 'F':
Compound: short-chain specific acyl-coa dehydrogenase,
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2VIG (384-End)
  - conflict see remark 9 (180)
- Uniprot P16219 (Start-383)
Domains in SCOPe 2.04: d2vigf1, d2vigf2
Chain 'G':
Compound: short-chain specific acyl-coa dehydrogenase,
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2VIG
  - conflict see remark 9 (180)
- Uniprot P16219
Domains in SCOPe 2.04: d2vigg1, d2vigg2
Chain 'H':
Compound: short-chain specific acyl-coa dehydrogenase,
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2VIG (384-End)
  - conflict see remark 9 (180)
- Uniprot P16219 (Start-383)
Domains in SCOPe 2.04: d2vigh1, d2vigh2
Heterogens: FAD, EDO, COS, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2vigA (A:)
mqsvelpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeel
ggagldylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdk
igcfalsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnk
sisaflvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtl
dmgrigiasqalgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarllt
wraamlkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdarit
eiyegtseiqrlviaghllrsyrsaenlyfq