PDB entry 2vhl

View 2vhl on RCSB PDB site
Description: the three-dimensional structure of the n-acetylglucosamine-6-phosphate deacetylase from bacillus subtilis
Class: hydrolase
Keywords: n- acetyleglucosamine-6-phosphate, carbohydrate metabolism, hydrolase, deacetylase, bacillus subtilis
Deposited on 2007-11-22, released 2007-12-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.208
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2vhla1, d2vhla2
  • Chain 'B':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2vhlb1, d2vhlb2
  • Heterogens: GLP, PGE, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vhlA (A:)
    maesllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpgmi
    dihihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnarewkaa
    eessllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivtlape
    edqhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrepgvig
    talahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefggqsv
    tvrgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdrkgsv
    tvgkdadlvivssdcevilticrgniafiskeadqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhlA (A:)
    esllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpgmidi
    hihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnarewkaaee
    ssllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivtlapeed
    qhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrepgvigta
    lahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefggqsvtv
    rgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdrkgsvtv
    gkdadlvivssdcevilticrgniafiskead
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vhlB (B:)
    maesllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpgmi
    dihihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnarewkaa
    eessllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivtlape
    edqhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrepgvig
    talahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefggqsv
    tvrgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdrkgsv
    tvgkdadlvivssdcevilticrgniafiskeadqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhlB (B:)
    aesllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpgmid
    ihihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnarewkaae
    essllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivtlapee
    dqhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrepgvigt
    alahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefggqsvt
    vrgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdrkgsvt
    vgkdadlvivssdcevilticrgniafiskead