PDB entry 2vhb

View 2vhb on RCSB PDB site
Description: azide adduct of the bacterial hemoglobin from vitreoscilla stercoraria
Deposited on 1997-02-19, released 1998-02-25
The last revision prior to the SCOP 1.59 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.197
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d2vhba_
  • Chain 'B':
    Domains in SCOP 1.59: d2vhbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vhbA (A:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
    laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
    wgkaygviadvfiqveadlyaqave
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhbA (A:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfeqpkalamtvlaaaqnie
    nlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvi
    advfiqveadlyaqave
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vhbB (B:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
    laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
    wgkaygviadvfiqveadlyaqav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhbB (B:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfleqpkalamtvlaaaqni
    enlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygv
    iadvfiqveadlyaqav