PDB entry 2vgz

View 2vgz on RCSB PDB site
Description: crystal structure of human kynurenine aminotransferase II
Class: transferase
Keywords: alternative splicing, multifunctional enzyme, transit peptide, aminotransferase, pyridoxal phosphate, plp enzyme, kynurenine, transferase, mitochondrion
Deposited on 2007-11-16, released 2007-12-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kynurenine/alpha-aminoadipate aminotransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VGZ (0-2)
    • Uniprot Q8N5Z0 (3-426)
    Domains in SCOPe 2.05: d2vgza_
  • Chain 'B':
    Compound: kynurenine/alpha-aminoadipate aminotransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VGZ (0-2)
    • Uniprot Q8N5Z0 (3-426)
    Domains in SCOPe 2.05: d2vgzb_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vgzA (A:)
    mlenyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitveng
    ktiqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsq
    qglckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrw
    kpedaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqf
    nkfrvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstf
    nqlmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwi
    kvkgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvla
    qlikesl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgzA (A:)
    mlenyarfitaasaarnpspsmislagglpnpnmfpfktavitvengktiqfgeemmkra
    lqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqglckvfemiinp
    gdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkpedaknpqkntp
    kflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnkfrvptflsmdv
    dgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnqlmisqllhewg
    eegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikvkgindvkelie
    ekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaqlikesl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vgzB (B:)
    mlenyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitveng
    ktiqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsq
    qglckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrw
    kpedaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqf
    nkfrvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstf
    nqlmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwi
    kvkgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvla
    qlikesl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgzB (B:)
    mlenyarfitaasaarnpspsmislagglpnpnmfpfktavitvengktiqfgeemmkra
    lqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqglckvfemiinp
    gdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkpedaknpqkntp
    kflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnkfrvptflsmdv
    dgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnqlmisqllhewg
    eegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikvkgindvkelie
    ekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaqlikesl