PDB entry 2vgp

View 2vgp on RCSB PDB site
Description: crystal structure of aurora b kinase in complex with a aminothiazole inhibitor
Class: transferase
Keywords: nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase, cancer, incenp, nucleus, mitosis, aurora b, metal-binding, aminothiazole, phosphorylation, magnesium, cell cycle, centromere, microtubule
Deposited on 2007-11-15, released 2008-02-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.208
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 12-a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vgpa_
  • Chain 'B':
    Compound: serine/threonine-protein kinase 12-a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vgpb_
  • Chain 'C':
    Compound: inner centromere protein a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: inner centromere protein a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AD6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vgpA (A:)
    talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
    lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
    eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
    pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
    dliskllryhppqrlplkgvmehpwvkansrrvlppvyqstqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgpA (A:)
    ftiddfdigrplgkgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqshlrh
    pnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhycher
    kvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemiegkthdekv
    dlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllryhppq
    rlplkgvmehpwvkansrrvlppvyq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vgpB (B:)
    talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
    lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
    eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
    pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
    dliskllryhppqrlplkgvmehpwvkansrrvlppvyqstqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgpB (B:)
    talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
    lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
    eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
    pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
    dliskllryhppqrlplkgvmehpwvkansrrvlppvy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.